PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_6.121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family ZF-HD
Protein Properties Length: 328aa    MW: 37087.7 Da    PI: 9.2637
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_6.121genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer108.83.1e-34119175360
                  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                                   v+Y+eClkNhAas+Ggh+vDGCgEfmps geeg+ ++lkCaAC+CHRnFHR+e + e
  evm.model.supercontig_6.121 119 VVKYRECLKNHAASMGGHVVDGCGEFMPS-GEEGSLESLKCAACDCHRNFHRKEIDGE 175
                                  589*************************9.999********************98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-23116174IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.3E-31120172IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.4E-32121172IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.963122171IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.2E-18247318IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.9E-28252322IPR009057Homeodomain-like
TIGRFAMsTIGR015652.2E-26261318IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGIPSYNSPV AERRRGDHHH HHHHHHPVHG DSVVFQPHQT LDHHHHHLLR HDQLQYVNHQ  60
QIHNTPRRDP DPEPELDPDR VPTSSPTSSK SNQDSPPRAP QRPSPTPAAI DSAAPAPVVV  120
KYRECLKNHA ASMGGHVVDG CGEFMPSGEE GSLESLKCAA CDCHRNFHRK EIDGETPRRN  180
NTIILPPPHL QPHQLPQLYH HRHHHRLISQ GLLPSPSLPA GPLPPMMMNF GGGGTAAESS  240
SEDLNMLQSN NNTVGKTSRS KKRFRTKFSQ EQKDKMLEFA EKLGWKIQKQ DEKEVQQFCS  300
QVNVTKQVFK VWMHNNKQVV LKKKQIM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-212603171673ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099626.12e-87PREDICTED: zinc-finger homeodomain protein 6
SwissprotQ9ZPW73e-67ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A068U3222e-86A0A068U322_COFCA; Uncharacterized protein
STRINGPOPTR_0007s12970.14e-85(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.19e-52homeobox protein 24